PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN05299.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 265aa    MW: 31166.1 Da    PI: 9.5271
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN05299.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-162370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd llv++v+++  g+W+++ar   ++R +k+c++rw +yl
       KHN05299.1 23 KGPWTAEEDRLLVEYVRLHCEGRWNSVARLARLKRNGKSCRLRWVNYL 70
                     79******************************99************97 PP

2Myb_DNA-binding52.71e-1676120147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
       KHN05299.1  76 RGQITPQEESIILELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 120
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0781870IPR017930Myb domain
SMARTSM007172.3E-132272IPR001005SANT/Myb domain
SuperFamilySSF466892.85E-2822117IPR009057Homeodomain-like
PfamPF002491.2E-142370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-222477IPR009057Homeodomain-like
CDDcd001672.21E-92570No hitNo description
PROSITE profilePS5129424.92871125IPR017930Myb domain
SMARTSM007175.8E-1575123IPR001005SANT/Myb domain
PfamPF002491.5E-1476120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2478124IPR009057Homeodomain-like
CDDcd001675.42E-1080121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MYWGEVMAGH VGRGVLEEEV WRKGPWTAEE DRLLVEYVRL HCEGRWNSVA RLARLKRNGK  60
SCRLRWVNYL RPDLKRGQIT PQEESIILEL HARWGNRWST IARSLPGRTD NEIKNYWRTH  120
FKKKAKSPSD AAEKARNRLM RKQQFHQQQQ QQQQLQQQHR AQQQQMQFNF DMKGIMAMLE  180
DDIHRTPYKS QSRQEMINMH QNTTEEQGYL YSMLNDNSSA SSAPETSAEE VLWDGLWNID  240
DVHGNFSVAS AASRFGLYNL VAPFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-26512510128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0967530.0BT096753.1 Soybean clone JCVI-FLGm-15B2 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001241353.10.0uncharacterized protein LOC100819404
TrEMBLA0A0B2PCT30.0A0A0B2PCT3_GLYSO; Transcription factor MYB48
STRINGGLYMA17G17560.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.13e-80myb domain protein 305
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]